PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00031.1.g00410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 356aa    MW: 38077.9 Da    PI: 10.2738
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00031.1.g00410.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.63.3e-191863147
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                  +g+W++eEde l ++v+++G ++W++I+r ++ gR++k+c++rw + 
  Zmw_sc00031.1.g00410.1.sm.mk 18 KGPWSPEEDEALQRLVARHGARNWSLISRSIP-GRSGKSCRLRWCNQ 63
                                  79******************************.***********985 PP

2Myb_DNA-binding55.21.6e-1772114347
                                   SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   ++T+eEde +++a++++G++ W+tIar +  gRt++ +k++w++ 
  Zmw_sc00031.1.g00410.1.sm.mk  72 PFTPEEDETILRAHARFGNK-WATIARLLS-GRTDNAIKNHWNST 114
                                   89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.5971368IPR017930Myb domain
SuperFamilySSF466894.12E-3215111IPR009057Homeodomain-like
SMARTSM007178.3E-171766IPR001005SANT/Myb domain
PfamPF002492.3E-181863IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-261971IPR009057Homeodomain-like
CDDcd001675.53E-162062No hitNo description
SMARTSM007177.1E-1569117IPR001005SANT/Myb domain
PROSITE profilePS5129420.80970119IPR017930Myb domain
CDDcd001674.91E-1272115No hitNo description
Gene3DG3DSA:1.10.10.609.1E-2472118IPR009057Homeodomain-like
PfamPF002499.7E-1572114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MASPSCRGGS SKDVDRIKGP WSPEEDEALQ RLVARHGARN WSLISRSIPG RSGKSCRLRW  60
CNQLSPQVEH RPFTPEEDET ILRAHARFGN KWATIARLLS GRTDNAIKNH WNSTLKRKYY  120
ASASGAAAGG ASVDLAAVAP VDEEEMRRPL KRTSSDGHPG LSFSPGSPSG SDVSDSSHHS  180
LPSVMPSSSA APAPTSSQQQ QQQQQHVYRP VPRAGGVVVL PASMAPRPPS PPPPQQPPPQ  240
APATSLSLSL SPPGLDRPDP SPSLSPAAPP PAHVQQHPHP SAPSQMPQPA SLPFQLHPPA  300
PKPPAPAPFS SEFLSMMKEM IRIEVRNYMS GSGLEPRSGA DVHAATQRMM GMAKIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-38151184107B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001151336.11e-142sucrose responsive element binding protein
TrEMBLB6TZ851e-142B6TZ85_MAIZE; Sucrose responsive element binding protein
STRINGGRMZM2G050550_P011e-141(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154